Cilp1 antibody

WebNov 22, 2024 · CILP1 is an extracellular matrix (ECM) protein abundant in articular cartilage 6 and has been implicated in several diseases … WebThe CILP-1 (cartilage intermediate-layer protein 1) gene product is a 132 kDa (predicted) monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor for two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog.

CILP1 as a biomarker for right ventricular maladaptation in …

WebOct 28, 2011 · CILP-1 is a pro-form of two polypeptides, and is cleaved into distinct N- and C-terminal fragments at a furin endoprotease consensus site ( 7 ). The N-terminal of CILP-1 has been shown to bind to and inhibit TGFβ1 in vitro ( 8 … WebDetector antibody conjugate. Biotin. Label or dye. HRP . Gene aliases. CILP, CILP-1, HsT18872, UNQ602/PRO1188. Gene ID (Human) 8483. Gene symbol. CILP. UniProt ID (Human) O75339. Show Less . About This Kit. Human CILP-1 quantitates human CILP-1 in serum, plasma, supernatant. The assay will exclusively recognize both natural and … camouflage 6190 https://kathurpix.com

Anti-CILP1 Antibody - Bosterbio

WebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and specificity - Long-term security of supply - Animal-free … WebHuman CILP-1 N-Terminal Fragment Biotinylated Antibody. Cat # BAF5504. Human URB Antibody. Cat # AF3410. Citations (1) Recombinant Human Protocadherin gamma C3 Protein, CF. ... (CILP1): A novel mediator of cardiac extracellular matrix remodelling Authors: FA van Nieuwe, C Munts, RC Op't Veld, A González, J Díez, S Heymans, B ... WebCited in 1 publication. View Human CILP-1 N-Terminal Fragment Antibody (AF5504) validated in Human & Simple Western, Western Blot from R&D Systems, Inc. a Bio-Techne Brand. first ruler of the mongol empire

(A06239) Anti-CILP1 Antibody (A06239) - Boster Biological …

Category:Human CILP-1 N-Terminal Fragment Antibody AF5504: …

Tags:Cilp1 antibody

Cilp1 antibody

Human CILP-1 N-Terminal Fragment Antibody - Bio-Techne

WebOct 6, 2024 · Rationale: Cartilage intermediate layer protein 1 (Cilp1) is a secreted extracellular matrix (ECM) protein normally associated with bone and cartilage development. Its function and mechanism of... WebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and specificity - Long-term security of supply - Animal-free …

Cilp1 antibody

Did you know?

WebPolyclonal Antibody for studying CLIP1/CLIP170. Cited in 5 publications. Validated for Western Blotting. Highly specific and rigorously validated in-house, CLIP1/CLIP170 Antibody (CST #8977) is ready to ship. WebMar 21, 2024 · CILP (Cartilage Intermediate Layer Protein) is a Protein Coding gene. Diseases associated with CILP include Intervertebral Disc Disease and Osteoarthritis . …

Web购物车里没有产品. Anti-MHC Class II Antibody [6C6] (ab55152) 产品货号 产品 WebOct 8, 2024 · In mice, the amount of RV CILP1 was markedly higher after banding than after sham. Control patients had lower CILP1 serum levels than all other groups (p<0.001). CILP1 concentrations were higher in PH patients with maladaptive RV function than those with adaptive RV function (p<0.001), LV pressure overload (p<0.001), and DCM (p=0.003).

WebCD74, also known as CLIP, is a 33.5kD homotrimer and functions as a MHC class II chaperone for exogenous peptides and other MHC class II molecules. CD74 binds MIF and regulates innate and adaptive immunity through CD44 signaling. It is found primarily on B-cells, monocytes, macrophages and dendritic

WebThe CLP1 Antibody from MyBioSource.com is a Rabbit Polyclonal antibody to CLP1. This antibody recognizes Human, Mouse, and Rat antigen. The CLP1 Antibody has been …

Web(A06239) Anti-CILP1 Antibody (A06239) Supplier Boster Biological Technology. Host Rabbit View Product On Supplier's Website. Add to Procurement List Product is on your … camouflage 2023WebBoster Bio Anti-CILP1 Antibody catalog # A06239. Tested in ELISA, WB applications. This antibody reacts with Human. Supplied as 100ul in Liquid form antibody. Anti-CILP1 … camouflage abdeckplaneWebNov 18, 2008 · The synthesis of cartilage intermediate layer protein (CILP), which was identified and purified from human articular cartilage ( Lorenzo et al., 1998 ), increases in early osteoarthrosis cartilage. By RT-PCR using human articular cartilage RNA and degenerate primers based on the amino acid sequence of CILP, and by screening a … first runecarver memoryWebab251162 is the carrier-free version of ab192881. Our carrier-free antibodies are typically supplied in a PBS-only formulation, purified and free of BSA, sodium azide and glycerol. … camouflage 83WebBackground: CILP-1 The CILP-1 (cartilage intermediate-layer protein 1) gene product is a monomeric glycoprotein precursor of two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog. It is found in both hyaline and fibrocartilage. camouflage 2 piece tracksuit for little boysWebBackground. Cytoplasmic FMR1-interacting protein 1 (CYFIP1) is a component of the CYFIP1/EIF4E/FMR1 complex which mediates translational repression by binding … camouflage 4kWebJun 1, 2024 · Cilp1 polyclonal antibody was raised in rabbits against a synthetic peptide (RQTMLAQSVRRVQPVKRTPKTLAKPADSQE) corresponding to preproCILP1 22-51, after conjugating with keyhole limpet hemocyanin via its C-terminal cysteine. Antibodies for immunofluorescence staining of 4′, 6-diamidino-2-phenylindole (DAPI) and alpha-smooth … camouflage abstract